PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10225049g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 350aa    MW: 39233.5 Da    PI: 7.1789
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10225049g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-181562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd++l+++ + +G  tW+t+++  g+ R++k+c++rw +yl
  MA_10225049g0010 15 RGPWTAEEDQKLIHYLQHHGLATWRTVPKLAGLSRCGKSCRLRWTNYL 62
                      89********************************************97 PP

2Myb_DNA-binding48.52.1e-1568111146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg ++  Ed++++++++ lG++ W++Ia++++ gRt++++k++w++
  MA_10225049g0010  68 RGTFSIHEDLIIIRLHAILGNK-WSAIASRLP-GRTDNEIKNHWNS 111
                       79999*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-23765IPR009057Homeodomain-like
PROSITE profilePS5129418.0561062IPR017930Myb domain
SuperFamilySSF466898.99E-3012109IPR009057Homeodomain-like
SMARTSM007171.9E-131464IPR001005SANT/Myb domain
PfamPF002498.4E-161562IPR001005SANT/Myb domain
CDDcd001673.44E-101762No hitNo description
PROSITE profilePS5129425.00163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2466117IPR009057Homeodomain-like
SMARTSM007177.7E-1467115IPR001005SANT/Myb domain
PfamPF002491.5E-1368111IPR001005SANT/Myb domain
CDDcd001673.34E-1075113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MVRAPCCVDH KGLKRGPWTA EEDQKLIHYL QHHGLATWRT VPKLAGLSRC GKSCRLRWTN  60
YLRPDIKRGT FSIHEDLIII RLHAILGNKW SAIASRLPGR TDNEIKNHWN SRLKKQLLIM  120
GIDPVTHGLL PIAHRDSFMA SSSNVGISID AGLNTGLVES ELGLARDYVN NIADEYSWLQ  180
LTQILATINN TVMPPVWARP CSENSLIVPS ISMDQLLRPQ TSRWFHGFQN DITQGFDSRQ  240
KDPIDNNALL QEALQFSNLE RKSEGMVNMI HSSGIPSILT NETDVSRDEL PPDKEIMYND  300
SRPSYNGGIS EILESAVQYH PNDPFGSPIS SADIPAARPD LPNKGDKVNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30131175108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-67MYB-like 102